Lineage for d1hph__ (1hph -)
- Root: SCOP 1.57
- Class j: Peptides [58231] (84 folds)
- Fold j.15: Parathyroid hormone fragments (residues between 1 and 39) [58378] (1 superfamily)
- Superfamily j.15.1: Parathyroid hormone fragments (residues between 1 and 39) [58379] (1 family)
- Family j.15.1.1: Parathyroid hormone fragments (residues between 1 and 39) [58380] (1 protein)
- Protein Parathyroid hormone fragments (residues between 1 and 39) [58381] (2 species)
- Species Human (Homo sapiens) [TaxId:9606] [58382] (14 PDB entries)
- Domain d1hph__: 1hph - [46159]
Details for d1hph__
PDB Entry: 1hph (more details)
PDB Description: structure of human parathyroid hormone 1-37 in solution
SCOP Domain Sequences for d1hph__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hph__ j.15.1.1 (-) Parathyroid hormone fragments (residues between 1 and 39) {Human (Homo sapiens)}
svseiqlmhnlgkhlnsmervewlrkklqdvhnfval
SCOP Domain Coordinates for d1hph__ are not available.
Timeline for d1hph__:
- d1hph__ first appeared (with stable ids) in SCOP 1.55
- d1hph__ appears in SCOP 1.59
- d1hph__ appears in the current release, SCOPe 2.08, called d1hpha_