SCOPe 2.08: Domain d1zwga1: 1zwg A:2-35

Lineage for d1zwga1 (1zwg A:2-35)

1. Root: SCOPe 2.08

2. Class j: Peptides [58231] (151 folds)

3. Fold j.15: Parathyroid hormone fragments (residues between 1 and 39) [58378] (1 superfamily)

4. Superfamily j.15.1: Parathyroid hormone fragments (residues between 1 and 39) [58379] (1 family)

5. Family j.15.1.1: Parathyroid hormone fragments (residues between 1 and 39) [58380] (1 protein)

6. Protein Parathyroid hormone fragments (residues between 1 and 39) [58381] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [58382] (14 PDB entries)

8. Domain d1zwga1: 1zwg A:2-35 [46158]
   Other proteins in same PDB: d1zwga2

Details for d1zwga1

PDB Entry: 1zwg

PDB Description: succinyl human parathyroid hormone 4-37, nmr, 10 structures

PDB Compounds: (A:) parathyroid hormone

SCOPe Domain Sequences for d1zwga1:

Sequence; same for both SEQRES and ATOM records:

>d1zwga1 j.15.1.1 (A:2-35) Parathyroid hormone fragments (residues between 1 and 39) {Human (Homo sapiens) [TaxId: 9606]}
eiqlmhnlgkhlnsmervewlrkklqdvhnfval

Timeline for d1zwga1:

• d1zwga1 first appeared (with stable ids) in SCOP 1.55, called d1zwg__
  
• d1zwga1 was called d1zwga_ in SCOPe 2.07