Lineage for d1zwga1 (1zwg A:2-35)

  1. Root: SCOPe 2.08
  2. 3045664Class j: Peptides [58231] (151 folds)
  3. 3046186Fold j.15: Parathyroid hormone fragments (residues between 1 and 39) [58378] (1 superfamily)
  4. 3046187Superfamily j.15.1: Parathyroid hormone fragments (residues between 1 and 39) [58379] (1 family) (S)
  5. 3046188Family j.15.1.1: Parathyroid hormone fragments (residues between 1 and 39) [58380] (1 protein)
  6. 3046189Protein Parathyroid hormone fragments (residues between 1 and 39) [58381] (3 species)
  7. 3046192Species Human (Homo sapiens) [TaxId:9606] [58382] (14 PDB entries)
  8. 3046200Domain d1zwga1: 1zwg A:2-35 [46158]
    Other proteins in same PDB: d1zwga2

Details for d1zwga1

PDB Entry: 1zwg (more details)

PDB Description: succinyl human parathyroid hormone 4-37, nmr, 10 structures
PDB Compounds: (A:) parathyroid hormone

SCOPe Domain Sequences for d1zwga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zwga1 j.15.1.1 (A:2-35) Parathyroid hormone fragments (residues between 1 and 39) {Human (Homo sapiens) [TaxId: 9606]}
eiqlmhnlgkhlnsmervewlrkklqdvhnfval

SCOPe Domain Coordinates for d1zwga1:

Click to download the PDB-style file with coordinates for d1zwga1.
(The format of our PDB-style files is described here.)

Timeline for d1zwga1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1zwga2