SCOP 1.57: Domain d1fvya_: 1fvy A:

Lineage for d1fvya_ (1fvy A:)

1. Root: SCOP 1.57
2. Class j: Peptides [58231] (84 folds)
3. Fold j.15: Parathyroid hormone fragments (residues between 1 and 39) [58378] (1 superfamily)
4. Superfamily j.15.1: Parathyroid hormone fragments (residues between 1 and 39) [58379] (1 family)
5. Family j.15.1.1: Parathyroid hormone fragments (residues between 1 and 39) [58380] (1 protein)
6. Protein Parathyroid hormone fragments (residues between 1 and 39) [58381] (2 species)
7. Species Human (Homo sapiens) [TaxId:9606] [58382] (14 PDB entries)
8. Domain d1fvya_: 1fvy A: [46157]

Details for d1fvya_

PDB Entry: 1fvy

PDB Description: solution structure of the osteogenic 1-31 fragment of the human parathyroid hormone

SCOP Domain Sequences for d1fvya_:

Sequence; same for both SEQRES and ATOM records:

>d1fvya_ j.15.1.1 (A:) Parathyroid hormone fragments (residues between 1 and 39) {Human (Homo sapiens)}
svseiqlmhnlgkhlnsmervewlrkklqdv

SCOP Domain Coordinates for d1fvya_ are not available.

Timeline for d1fvya_:

• d1fvya_ first appeared (with stable ids) in SCOP 1.55
  
• d1fvya_ appears in SCOP 1.59
  
• d1fvya_ appears in the current release, SCOPe 2.08