SCOPe 2.01: Domain d1zwfa_: 1zwf A:

Lineage for d1zwfa_ (1zwf A:)

1. Root: SCOPe 2.01

2. Class j: Peptides [58231] (120 folds)

3. Fold j.15: Parathyroid hormone fragments (residues between 1 and 39) [58378] (1 superfamily)

4. Superfamily j.15.1: Parathyroid hormone fragments (residues between 1 and 39) [58379] (1 family)

5. Family j.15.1.1: Parathyroid hormone fragments (residues between 1 and 39) [58380] (1 protein)

6. Protein Parathyroid hormone fragments (residues between 1 and 39) [58381] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [58382] (14 PDB entries)

8. Domain d1zwfa_: 1zwf A: [46156]

Details for d1zwfa_

PDB Entry: 1zwf

PDB Description: structure of n-terminal acetylated human parathyroid hormone, nmr, 10 structures

PDB Compounds: (A:) parathyroid hormone

SCOPe Domain Sequences for d1zwfa_:

Sequence; same for both SEQRES and ATOM records:

>d1zwfa_ j.15.1.1 (A:) Parathyroid hormone fragments (residues between 1 and 39) {Human (Homo sapiens) [TaxId: 9606]}
eiqlmhnlgkhlnsmervewlrkklqdvhnfval

Timeline for d1zwfa_:

• d1zwfa_ first appeared (with stable ids) in SCOP 1.55, called d1zwf__
  
• d1zwfa_ appears in SCOP 1.75
  
• d1zwfa_ appears in SCOPe 2.02
  
• d1zwfa_ appears in the current release, SCOPe 2.08