Lineage for d1bwxa_ (1bwx A:)

  1. Root: SCOPe 2.02
  2. 1251156Class j: Peptides [58231] (120 folds)
  3. 1251674Fold j.15: Parathyroid hormone fragments (residues between 1 and 39) [58378] (1 superfamily)
  4. 1251675Superfamily j.15.1: Parathyroid hormone fragments (residues between 1 and 39) [58379] (1 family) (S)
  5. 1251676Family j.15.1.1: Parathyroid hormone fragments (residues between 1 and 39) [58380] (1 protein)
  6. 1251677Protein Parathyroid hormone fragments (residues between 1 and 39) [58381] (3 species)
  7. 1251680Species Human (Homo sapiens) [TaxId:9606] [58382] (14 PDB entries)
  8. 1251687Domain d1bwxa_: 1bwx A: [46155]

Details for d1bwxa_

PDB Entry: 1bwx (more details)

PDB Description: the solution structure of human parathyroid hormone fragment 1-39, nmr, 10 structures
PDB Compounds: (A:) parathyroid hormone

SCOPe Domain Sequences for d1bwxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bwxa_ j.15.1.1 (A:) Parathyroid hormone fragments (residues between 1 and 39) {Human (Homo sapiens) [TaxId: 9606]}
svseiqlmhnlgkhlnsmervewlrkklqdvhnfvalga

SCOPe Domain Coordinates for d1bwxa_:

Click to download the PDB-style file with coordinates for d1bwxa_.
(The format of our PDB-style files is described here.)

Timeline for d1bwxa_: