SCOP 1.73: Domain d1bwxa_: 1bwx A:

Lineage for d1bwxa_ (1bwx A:)

1. Root: SCOP 1.73

2. Class j: Peptides [58231] (120 folds)

3. Fold j.15: Parathyroid hormone fragments (residues between 1 and 39) [58378] (1 superfamily)

4. Superfamily j.15.1: Parathyroid hormone fragments (residues between 1 and 39) [58379] (1 family)

5. Family j.15.1.1: Parathyroid hormone fragments (residues between 1 and 39) [58380] (1 protein)

6. Protein Parathyroid hormone fragments (residues between 1 and 39) [58381] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [58382] (14 PDB entries)

8. Domain d1bwxa_: 1bwx A: [46155]

Details for d1bwxa_

PDB Entry: 1bwx

PDB Description: the solution structure of human parathyroid hormone fragment 1-39, nmr, 10 structures

PDB Compounds: (A:) parathyroid hormone

SCOP Domain Sequences for d1bwxa_:

Sequence; same for both SEQRES and ATOM records:

>d1bwxa_ j.15.1.1 (A:) Parathyroid hormone fragments (residues between 1 and 39) {Human (Homo sapiens) [TaxId: 9606]}
svseiqlmhnlgkhlnsmervewlrkklqdvhnfvalga

Timeline for d1bwxa_:

• d1bwxa_ first appeared (with stable ids) in SCOP 1.55, called d1bwx__
  
• d1bwxa_ was called d1bwx__ in SCOP 1.71
  
• d1bwxa_ appears in SCOP 1.75
  
• d1bwxa_ appears in the current release, SCOPe 2.08