Lineage for d1bl1__ (1bl1 -)

  1. Root: SCOP 1.55
  2. Class j: Peptides [58231] (77 folds)
  3. Fold j.15: Parathyroid hormone fragments (residues between 1 and 39) [58378] (1 superfamily)
  4. Superfamily j.15.1: Parathyroid hormone fragments (residues between 1 and 39) [58379] (1 family) (S)
  5. Family j.15.1.1: Parathyroid hormone fragments (residues between 1 and 39) [58380] (1 protein)
  6. Protein Parathyroid hormone fragments (residues between 1 and 39) [58381] (2 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [58382] (14 PDB entries)
  8. Domain d1bl1__: 1bl1 - [46154]

Details for d1bl1__

PDB Entry: 1bl1 (more details)

PDB Description: pth receptor n-terminus fragment, nmr, 1 structure

SCOP Domain Sequences for d1bl1__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bl1__ j.15.1.1 (-) Parathyroid hormone fragments (residues between 1 and 39) {Human (Homo sapiens)}
seavkfltnetrerevfdrlgmiytvgysvc

SCOP Domain Coordinates for d1bl1__ are not available.

Timeline for d1bl1__: