Lineage for d1et1b_ (1et1 B:)

  1. Root: SCOP 1.57
  2. Class j: Peptides [58231] (84 folds)
  3. Fold j.15: Parathyroid hormone fragments (residues between 1 and 39) [58378] (1 superfamily)
  4. Superfamily j.15.1: Parathyroid hormone fragments (residues between 1 and 39) [58379] (1 family) (S)
  5. Family j.15.1.1: Parathyroid hormone fragments (residues between 1 and 39) [58380] (1 protein)
  6. Protein Parathyroid hormone fragments (residues between 1 and 39) [58381] (2 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [58382] (14 PDB entries)
  8. Domain d1et1b_: 1et1 B: [46153]

Details for d1et1b_

PDB Entry: 1et1 (more details), 0.9 Å

PDB Description: crystal structure of human parathyroid hormone 1-34 at 0.9 a resolution

SCOP Domain Sequences for d1et1b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1et1b_ j.15.1.1 (B:) Parathyroid hormone fragments (residues between 1 and 39) {Human (Homo sapiens)}
svseiqlmhnlgkhlnsmervewlrkklqdvhnf

SCOP Domain Coordinates for d1et1b_ are not available.

Timeline for d1et1b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1et1a_