Lineage for d1b4ia_ (1b4i A:)

  1. Root: SCOPe 2.07
  2. 2596047Class j: Peptides [58231] (148 folds)
  3. 2596536Fold j.12: Inactivation gate of potassium and sodium channels [58358] (1 superfamily)
  4. 2596537Superfamily j.12.1: Inactivation gate of potassium and sodium channels [58359] (1 family) (S)
  5. 2596538Family j.12.1.1: Inactivation gate of potassium and sodium channels [58360] (4 proteins)
    it is not a true family
  6. 2596539Protein Potassium channel RAW3 [58361] (2 species)
  7. 2596542Species Synthetic, expressed in Escherichia coli [58363] (2 PDB entries)
  8. 2596544Domain d1b4ia_: 1b4i A: [46145]

Details for d1b4ia_

PDB Entry: 1b4i (more details)

PDB Description: Control of K+ Channel Gating by protein phosphorylation: structural switches of the inactivation gate, NMR, 22 structures
PDB Compounds: (A:) potassium channel

SCOPe Domain Sequences for d1b4ia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b4ia_ j.12.1.1 (A:) Potassium channel RAW3 {Synthetic, expressed in Escherichia coli}
missvcvssyrgrksgnkppsktclkeema

SCOPe Domain Coordinates for d1b4ia_:

Click to download the PDB-style file with coordinates for d1b4ia_.
(The format of our PDB-style files is described here.)

Timeline for d1b4ia_: