Lineage for d1b4g__ (1b4g -)

  1. Root: SCOP 1.55
  2. Class j: Peptides [58231] (77 folds)
  3. Fold j.12: Inactivation gate of potassium and sodium channels [58358] (1 superfamily)
  4. Superfamily j.12.1: Inactivation gate of potassium and sodium channels [58359] (1 family) (S)
  5. Family j.12.1.1: Inactivation gate of potassium and sodium channels [58360] (3 proteins)
  6. Protein Potassium channel RAW3 [58361] (2 species)
  7. Species Synthetic, expressed in Escherichia coli [58363] (2 PDB entries)
  8. Domain d1b4g__: 1b4g - [46144]

Details for d1b4g__

PDB Entry: 1b4g (more details)

PDB Description: control of k+ channel gating by protein phosphorylation: structural switches of the inactivation gate, nmr, 22 structures

SCOP Domain Sequences for d1b4g__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b4g__ j.12.1.1 (-) Potassium channel RAW3 {Synthetic, expressed in Escherichia coli}
missvcvssyrgrksgnkppsktclkeema

SCOP Domain Coordinates for d1b4g__ are not available.

Timeline for d1b4g__: