![]() | Class j: Peptides [58231] (151 folds) |
![]() | Fold j.12: Inactivation gate of potassium and sodium channels [58358] (1 superfamily) |
![]() | Superfamily j.12.1: Inactivation gate of potassium and sodium channels [58359] (1 family) ![]() |
![]() | Family j.12.1.1: Inactivation gate of potassium and sodium channels [58360] (4 proteins) it is not a true family |
![]() | Protein Potassium channel RAW3 [58361] (2 species) |
![]() | Species Synthetic, expressed in Escherichia coli [58363] (2 PDB entries) |
![]() | Domain d1b4ga_: 1b4g A: [46144] |
PDB Entry: 1b4g (more details)
SCOPe Domain Sequences for d1b4ga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b4ga_ j.12.1.1 (A:) Potassium channel RAW3 {Synthetic, expressed in Escherichia coli} missvcvssyrgrksgnkppsktclkeema
Timeline for d1b4ga_: