Lineage for d1b4ga_ (1b4g A:)

  1. Root: SCOPe 2.08
  2. 3045664Class j: Peptides [58231] (151 folds)
  3. 3046153Fold j.12: Inactivation gate of potassium and sodium channels [58358] (1 superfamily)
  4. 3046154Superfamily j.12.1: Inactivation gate of potassium and sodium channels [58359] (1 family) (S)
  5. 3046155Family j.12.1.1: Inactivation gate of potassium and sodium channels [58360] (4 proteins)
    it is not a true family
  6. 3046156Protein Potassium channel RAW3 [58361] (2 species)
  7. 3046159Species Synthetic, expressed in Escherichia coli [58363] (2 PDB entries)
  8. 3046160Domain d1b4ga_: 1b4g A: [46144]

Details for d1b4ga_

PDB Entry: 1b4g (more details)

PDB Description: control of k+ channel gating by protein phosphorylation: structural switches of the inactivation gate, nmr, 22 structures
PDB Compounds: (A:) potassium channel

SCOPe Domain Sequences for d1b4ga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b4ga_ j.12.1.1 (A:) Potassium channel RAW3 {Synthetic, expressed in Escherichia coli}
missvcvssyrgrksgnkppsktclkeema

SCOPe Domain Coordinates for d1b4ga_:

Click to download the PDB-style file with coordinates for d1b4ga_.
(The format of our PDB-style files is described here.)

Timeline for d1b4ga_: