Lineage for d1bdea_ (1bde A:)

  1. Root: SCOPe 2.07
  2. 2650239Class j: Peptides [58231] (148 folds)
  3. 2650710Fold j.11: VPR protein fragments [58353] (1 superfamily)
  4. 2650711Superfamily j.11.1: VPR protein fragments [58354] (1 family) (S)
  5. 2650712Family j.11.1.1: VPR protein fragments [58355] (1 protein)
  6. 2650713Protein VPR protein fragments [58356] (1 species)
  7. 2650714Species Human immunodeficiency virus type 1 [TaxId:11676] [58357] (12 PDB entries)
  8. 2650723Domain d1bdea_: 1bde A: [46142]
    residues 50-82

Details for d1bdea_

PDB Entry: 1bde (more details)

PDB Description: helical structure of polypeptides from the c-terminal half of hiv-1 vpr, nmr, 20 structures
PDB Compounds: (A:) vpr protein

SCOPe Domain Sequences for d1bdea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bdea_ j.11.1.1 (A:) VPR protein fragments {Human immunodeficiency virus type 1 [TaxId: 11676]}
ygdtwagveaiirilqqllfihfrigcrhsrig

SCOPe Domain Coordinates for d1bdea_:

Click to download the PDB-style file with coordinates for d1bdea_.
(The format of our PDB-style files is described here.)

Timeline for d1bdea_: