Lineage for d1bde__ (1bde -)

  1. Root: SCOP 1.55
  2. Class j: Peptides [58231] (77 folds)
  3. Fold j.11: VPR protein fragments [58353] (1 superfamily)
  4. Superfamily j.11.1: VPR protein fragments [58354] (1 family) (S)
  5. Family j.11.1.1: VPR protein fragments [58355] (1 protein)
  6. Protein VPR protein fragments [58356] (1 species)
  7. Species Human immunodeficiency virus type 1 [TaxId:11676] [58357] (6 PDB entries)
  8. Domain d1bde__: 1bde - [46142]

Details for d1bde__

PDB Entry: 1bde (more details)

PDB Description: helical structure of polypeptides from the c-terminal half of hiv-1 vpr, nmr, 20 structures

SCOP Domain Sequences for d1bde__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bde__ j.11.1.1 (-) VPR protein fragments {Human immunodeficiency virus type 1}
ygdtwagveaiirilqqllfihfrigcrhsrig

SCOP Domain Coordinates for d1bde__ are not available.

Timeline for d1bde__: