Lineage for d1vpc__ (1vpc -)

  1. Root: SCOP 1.55
  2. Class j: Peptides [58231] (77 folds)
  3. Fold j.11: VPR protein fragments [58353] (1 superfamily)
  4. Superfamily j.11.1: VPR protein fragments [58354] (1 family) (S)
  5. Family j.11.1.1: VPR protein fragments [58355] (1 protein)
  6. Protein VPR protein fragments [58356] (1 species)
  7. Species Human immunodeficiency virus type 1 [TaxId:11676] [58357] (6 PDB entries)
  8. Domain d1vpc__: 1vpc - [46138]

Details for d1vpc__

PDB Entry: 1vpc (more details)

PDB Description: c-terminal domain (52-96) of the hiv-1 regulatory protein vpr, nmr, 1 structure

SCOP Domain Sequences for d1vpc__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vpc__ j.11.1.1 (-) VPR protein fragments {Human immunodeficiency virus type 1}
dtwtgvealirilqqllfihfrigcrhsrigiiqqrrtrngasks

SCOP Domain Coordinates for d1vpc__ are not available.

Timeline for d1vpc__: