Lineage for d1vpca_ (1vpc A:)

  1. Root: SCOPe 2.08
  2. Class j: Peptides [58231] (151 folds)
  3. Fold j.11: VPR protein fragments [58353] (1 superfamily)
  4. Superfamily j.11.1: VPR protein fragments [58354] (1 family) (S)
  5. Family j.11.1.1: VPR protein fragments [58355] (1 protein)
  6. Protein VPR protein fragments [58356] (1 species)
  7. Species Human immunodeficiency virus type 1 [TaxId:11676] [58357] (12 PDB entries)
  8. Domain d1vpca_: 1vpc A: [46138]
    residues 52-96

Details for d1vpca_

PDB Entry: 1vpc (more details)

PDB Description: c-terminal domain (52-96) of the hiv-1 regulatory protein vpr, nmr, 1 structure
PDB Compounds: (A:) vpr protein

SCOPe Domain Sequences for d1vpca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vpca_ j.11.1.1 (A:) VPR protein fragments {Human immunodeficiency virus type 1 [TaxId: 11676]}
dtwtgvealirilqqllfihfrigcrhsrigiiqqrrtrngasks

SCOPe Domain Coordinates for d1vpca_ are not available.

Timeline for d1vpca_: