Lineage for d1cw5a_ (1cw5 A:)

  1. Root: SCOPe 2.08
  2. Class j: Peptides [58231] (151 folds)
  3. Fold j.106: Leucocin-like bacteriocin [100898] (1 superfamily)
    consists of a conserved, disulfide-containing N-terminal region (forming a beta-sheet) and a C-terminal helix
  4. Superfamily j.106.1: Leucocin-like bacteriocin [100899] (1 family) (S)
  5. Family j.106.1.1: Leucocin-like bacteriocin [100900] (3 proteins)
  6. Protein Carnobacteriocin B2 [58276] (1 species)
  7. Species Carnobacterium piscicola [TaxId:2751] [58277] (2 PDB entries)
  8. Domain d1cw5a_: 1cw5 A: [46086]

Details for d1cw5a_

PDB Entry: 1cw5 (more details)

PDB Description: solution structure of carnobacteriocin b2
PDB Compounds: (A:) type iia bacteriocin carnobacteriocin b2

SCOPe Domain Sequences for d1cw5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cw5a_ j.106.1.1 (A:) Carnobacteriocin B2 {Carnobacterium piscicola [TaxId: 2751]}
vnygngvscsktkcsvnwgqafqerytaginsfvsgvasgagsigrrp

SCOPe Domain Coordinates for d1cw5a_ are not available.

Timeline for d1cw5a_: