SCOP 1.67: Domain d3leu__: 3leu -

Lineage for d3leu__ (3leu -)

1. Root: SCOP 1.67

2. Class j: Peptides [58231] (111 folds)

3. Fold j.106: Leucocin-like bacteriocin [100898] (1 superfamily)
   consists of a conserved, disulfide-containing N-terminal region (forming a beta-sheet) and a C-terminal helix

4. Superfamily j.106.1: Leucocin-like bacteriocin [100899] (1 family)

5. Family j.106.1.1: Leucocin-like bacteriocin [100900] (3 proteins)

6. Protein Leucocin [58254] (1 species)
   antibacterial peptide, bacteriocin

7. Species Leuconostoc gelidum [TaxId:1244] [58255] (3 PDB entries)

8. Domain d3leu__: 3leu - [46070]

Details for d3leu__

PDB Entry: 3leu

PDB Description: high resolution 1h nmr study of leucocin a in dodecylphosphocholine micelles, 19 structures (1:40 ratio of leucocin a:dpc) (0.1% tfa)

SCOP Domain Sequences for d3leu__:

Sequence; same for both SEQRES and ATOM records:

>d3leu__ j.106.1.1 (-) Leucocin {Leuconostoc gelidum}
kyygngvhctksgcsvnwgeafsagvhrlanggngfw

Timeline for d3leu__:

• d3leu__ first appeared (with stable ids) in SCOP 1.55
  
• d3leu__ appears in SCOP 1.65
  
• d3leu__ appears in SCOP 1.69
  
• d3leu__ appears in the current release, SCOPe 2.08, called d3leua_