Lineage for d2leu__ (2leu -)

  1. Root: SCOP 1.67
  2. 434008Class j: Peptides [58231] (111 folds)
  3. 435453Fold j.106: Leucocin-like bacteriocin [100898] (1 superfamily)
    consists of a conserved, disulfide-containing N-terminal region (forming a beta-sheet) and a C-terminal helix
  4. 435454Superfamily j.106.1: Leucocin-like bacteriocin [100899] (1 family) (S)
  5. 435455Family j.106.1.1: Leucocin-like bacteriocin [100900] (3 proteins)
  6. 435460Protein Leucocin [58254] (1 species)
    antibacterial peptide, bacteriocin
  7. 435461Species Leuconostoc gelidum [TaxId:1244] [58255] (3 PDB entries)
  8. 435463Domain d2leu__: 2leu - [46068]

Details for d2leu__

PDB Entry: 2leu (more details)

PDB Description: high resolution 1h nmr study of leucocin a in 90% aqueous trifluoroethanol (tfe) (0.1% tfa), 18 structures

SCOP Domain Sequences for d2leu__:

Sequence; same for both SEQRES and ATOM records: (download)

>d2leu__ j.106.1.1 (-) Leucocin {Leuconostoc gelidum}
kyygngvhctksgcsvnwgeafsagvhrlanggngfw

SCOP Domain Coordinates for d2leu__:

Click to download the PDB-style file with coordinates for d2leu__.
(The format of our PDB-style files is described here.)

Timeline for d2leu__: