Lineage for d3ldha_ (3ldh A:)
- Root: SCOPe 2.08
Class i: Low resolution protein structures [58117] (25 folds) 
Fold i.12: Proteins of incorrect, partial and unknown sequence [58207] (1 superfamily) Superfamily i.12.1: Proteins of incorrect, partial and unknown sequence [58208] (1 family) 
Family i.12.1.1: Proteins of incorrect, partial and unknown sequence [58209] (12 proteins) 
Protein Lactate dehydrogenase [58210] (1 species) Species Dogfish (Squalus acanthias) [TaxId:7797] [58211] (1 PDB entry) 
Domain d3ldha_: 3ldh A: [46015]
old structure, probably contains a sequence error
complexed with nad, pyr
Details for d3ldha_
PDB Entry: 3ldh (more details), 3 Å
PDB Description: a comparison of the structures of apo dogfish m4 lactate dehydrogenase and its ternary complexes
PDB Compounds: (A:) lactate dehydrogenaseSCOPe Domain Sequences for d3ldha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ldha_ i.12.1.1 (A:) Lactate dehydrogenase {Dogfish (Squalus acanthias) [TaxId: 7797]}
talkdklighlatsqeprsynkitvvgcdavgmadaisvlmkdladevalvdvmedklkg
emmdlehgslflhtakivsgkdysvsagsklvvitagarqqegesrlnlvqrnvnifkfi
ipnivkhspdclkelhpelgtdknkqdwklsglpmhriigsgcnldsarfrylmgerlgv
hsclvigwvigqhgdsvpsvwsgmwdaklhkdvvdsayeviklkgytswaiglvvsnpvd
vltyvawkgcsvadlaqtimkdlcrvhpvstmvkdfygikdnvflslpcvlnngishcni
vkmklkpdeeqqlqksattlwdiqkdlkf
SCOPe Domain Coordinates for d3ldha_:
Click to download the PDB-style file with coordinates for d3ldha_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3ldha_:
- d3ldha_ first appeared (with stable ids) in SCOP 1.55, called d3ldh__
- d3ldha_ appears in SCOPe 2.07
View in 3D