Lineage for d1fh1a_ (1fh1 A:)

  1. Root: SCOPe 2.08
  2. 3042554Class i: Low resolution protein structures [58117] (25 folds)
  3. 3044923Fold i.11: Computational models partly based on experimental data [58198] (1 superfamily)
  4. 3044924Superfamily i.11.1: Computational models partly based on experimental data [58199] (1 family) (S)
  5. 3044925Family i.11.1.1: Computational models partly based on experimental data [58200] (6 proteins)
    this is not a true family
  6. 3044932Protein Nodulation protein NodF [58205] (1 species)
  7. 3044933Species Rhizobium leguminosarum [TaxId:384] [58206] (1 PDB entry)
  8. 3044934Domain d1fh1a_: 1fh1 A: [46014]

Details for d1fh1a_

PDB Entry: 1fh1 (more details)

PDB Description: backbone fold of nodf
PDB Compounds: (A:) nodulation protein f

SCOPe Domain Sequences for d1fh1a_:

Sequence, based on SEQRES records: (download)

>d1fh1a_ i.11.1.1 (A:) Nodulation protein NodF {Rhizobium leguminosarum [TaxId: 384]}
ltleiisainklvkaengertsvalgeittdteltslgidslgladvlwdleqlygikie
mntadawsnlnnigdvveavrg

Sequence, based on observed residues (ATOM records): (download)

>d1fh1a_ i.11.1.1 (A:) Nodulation protein NodF {Rhizobium leguminosarum [TaxId: 384]}
ltleiisainklvlgladvlwdleqlnigdvveavrg

SCOPe Domain Coordinates for d1fh1a_:

Click to download the PDB-style file with coordinates for d1fh1a_.
(The format of our PDB-style files is described here.)

Timeline for d1fh1a_: