Lineage for d1d9sa_ (1d9s A:)

  1. Root: SCOPe 2.08
  2. 3042554Class i: Low resolution protein structures [58117] (25 folds)
  3. 3044923Fold i.11: Computational models partly based on experimental data [58198] (1 superfamily)
  4. 3044924Superfamily i.11.1: Computational models partly based on experimental data [58199] (1 family) (S)
  5. 3044925Family i.11.1.1: Computational models partly based on experimental data [58200] (6 proteins)
    this is not a true family
  6. 3044941Protein Tumor suppressor p15(ink4b) [58203] (1 species)
  7. 3044942Species Mouse (Mus musculus) [TaxId:10090] [58204] (1 PDB entry)
  8. 3044943Domain d1d9sa_: 1d9s A: [46013]

Details for d1d9sa_

PDB Entry: 1d9s (more details)

PDB Description: tumor suppressor p15(ink4b) structure by comparative modeling and nmr data
PDB Compounds: (A:) cyclin-dependent kinase 4 inhibitor b

SCOPe Domain Sequences for d1d9sa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d9sa_ i.11.1.1 (A:) Tumor suppressor p15(ink4b) {Mouse (Mus musculus) [TaxId: 10090]}
gspgihmlggssdaglataaargqvetvrqlleagadpnalnrfgrrpiqvmmmgsaqva
ellllhgaepncadpatltrpvhdaaregfldtlvvlhragarldvcdawgrlpvdlaee
qghrdiarylhaatgd

SCOPe Domain Coordinates for d1d9sa_:

Click to download the PDB-style file with coordinates for d1d9sa_.
(The format of our PDB-style files is described here.)

Timeline for d1d9sa_: