SCOPe 2.08: Domain d1ekya_: 1eky A:

Lineage for d1ekya_ (1eky A:)

1. Root: SCOPe 2.08

2. Class i: Low resolution protein structures [58117] (25 folds)

3. Fold i.11: Computational models partly based on experimental data [58198] (1 superfamily)

4. Superfamily i.11.1: Computational models partly based on experimental data [58199] (1 family)

5. Family i.11.1.1: Computational models partly based on experimental data [58200] (6 proteins)
   this is not a true family

6. Protein Cytochrome c' [58201] (1 species)

7. Species Rhodobacter capsulatus [TaxId:1061] [58202] (1 PDB entry)

8. Domain d1ekya_: 1eky A: [46012]
   complexed with hem

Details for d1ekya_

PDB Entry: 1eky

PDB Description: model structure from non-noe based nmr structure calculation

PDB Compounds: (A:) cytochrome c'

SCOPe Domain Sequences for d1ekya_:

Sequence; same for both SEQRES and ATOM records:

>d1ekya_ i.11.1.1 (A:) Cytochrome c' {Rhodobacter capsulatus [TaxId: 1061]}
adtkevleareayfkslggsmkamtgvakafdaeaakveaaklekilatdvaplfpagts
stdlpgqteakaaiwanmddfgakgkamheaggaviaaanagdgaafgaalqklggtcka
chddyreed

Timeline for d1ekya_:

• d1ekya_ first appeared (with stable ids) in SCOP 1.55
  
• d1ekya_ appears in SCOPe 2.07