Lineage for d1ffxa_ (1ffx A:)

  1. Root: SCOP 1.73
  2. 753709Class i: Low resolution protein structures [58117] (26 folds)
  3. 755256Fold i.10: Microtubule complexes [58193] (1 superfamily)
  4. 755257Superfamily i.10.1: Microtubule complexes [58194] (1 family) (S)
  5. 755258Family i.10.1.1: Microtubule complexes [58195] (2 proteins)
  6. 755264Protein Tubulin:stathmin-like domain complex [58196] (1 species)
  7. 755265Species interspecies complex: Rattus norvegicus and Bos taurus [58197] (1 PDB entry)
  8. 755266Domain d1ffxa_: 1ffx A: [46007]

Details for d1ffxa_

PDB Entry: 1ffx (more details), 3.95 Å

PDB Description: tubulin:stathmin-like domain complex
PDB Compounds: (A:) protein (tubulin)

SCOP Domain Sequences for d1ffxa_:

Sequence, based on SEQRES records: (download)

>d1ffxa_ i.10.1.1 (A:) Tubulin:stathmin-like domain complex {interspecies complex: Rattus norvegicus and Bos taurus}
mrecisihvgqagvqignacwelyclehgiqpdgqmpsdktigggddsfntffsetgagk
hvpravfvdleptvidevrtgtyrqlfhpeqlitgkedaannyarghytigkeiidlvld
rirkladqctglqgfsvfhsfgggtgsgftsllmerlsvdygkksklefsiypapqvsta
vvepynsiltthttlehsdcafmvdneaiydicrrnldierptytnlnrligqivssita
slrfdgalnvdltefqtnlvpyprahfplatyapvisaekayheqlsvaeitnacfepan
qmvkcdprhgkymaccllyrgdvvpkdvnaaiatiktkrtiqfvdwcptgfkvginyepp
tvvpggdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefse
aredmaalekdyeevgvdsv

Sequence, based on observed residues (ATOM records): (download)

>d1ffxa_ i.10.1.1 (A:) Tubulin:stathmin-like domain complex {interspecies complex: Rattus norvegicus and Bos taurus}
mrecisihvgqagvqignacwelyclehgiqpdgqmpsdktigggddavfvdleptvide
vrtgtyrqlfhpeqlitgkedaannyarghytigkeiidlvldrirkladqctglqgfsv
fhsfgggtgsgftsllmerlsvdygkksklefsiypapqvstavvepynsiltthttleh
sdcafmvdneaiydicrrnldierptytnlnrligqivssitaslrfdgalnvdltefqt
nlvpyprahfplatyapvisaekayheqlsvaeitnacfepanqmvkcdprhgkymaccl
lyrgdvvpkdvnaaiatiktkrtiqfvdwcptgfkvginyepptvvpggdlakvqravcm
lsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedmaalekdyeevgv
dsv

SCOP Domain Coordinates for d1ffxa_:

Click to download the PDB-style file with coordinates for d1ffxa_.
(The format of our PDB-style files is described here.)

Timeline for d1ffxa_: