Lineage for d1ei3c_ (1ei3 C:)

  1. Root: SCOPe 2.07
  2. 2592940Class i: Low resolution protein structures [58117] (25 folds)
  3. 2595263Fold i.9: Blood clotting [58187] (1 superfamily)
  4. 2595264Superfamily i.9.1: Blood clotting [58188] (1 family) (S)
  5. 2595265Family i.9.1.1: Blood clotting [58189] (1 protein)
  6. 2595266Protein Fibrinogen [58190] (2 species)
  7. 2595267Species Chicken (Gallus gallus) [TaxId:9031] [58192] (1 PDB entry)
  8. 2595270Domain d1ei3c_: 1ei3 C: [46005]

Details for d1ei3c_

PDB Entry: 1ei3 (more details), 5.5 Å

PDB Description: crystal structure of native chicken fibrinogen
PDB Compounds: (C:) fibrinogen

SCOPe Domain Sequences for d1ei3c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ei3c_ i.9.1.1 (C:) Fibrinogen {Chicken (Gallus gallus) [TaxId: 9031]}
yiatrenccilderfgsycpttcgiadffnkyrlttdgelleiegllqqatnstgsieyl
iqhiktiypsekqtlpqsieqltqkskkiieeiiryentilahentiqqltdmhimnsnk
itqlkqkiaqleshcqepckdtaeiqettgrdcqdiankgarksglyfikpqkakqsflv
yceidtygngwtvlqrrldgsedfrrnwvqykegfghlspddttefwlgnekihlittqs
tlpyalrieledwsgkkgtadyavfkvgteedkyrltyayfiggergdafdgfnfgddps
dksytyhngmrfstfdndndnfegncaeqdgsgwwmnrchaghlngpyyiggvysrdtgt
nsydngiiwatwrdrwysmkkttmkiipfnrlsidgq

SCOPe Domain Coordinates for d1ei3c_:

Click to download the PDB-style file with coordinates for d1ei3c_.
(The format of our PDB-style files is described here.)

Timeline for d1ei3c_: