Lineage for d1ei3d_ (1ei3 D:)

  1. Root: SCOP 1.55
  2. Class i: Low resolution protein structures [58117] (12 folds)
  3. Fold i.9: Blood clotting [58187] (1 superfamily)
  4. Superfamily i.9.1: Blood clotting [58188] (1 family) (S)
  5. Family i.9.1.1: Blood clotting [58189] (1 protein)
  6. Protein Fibrinogen [58190] (2 species)
  7. Species Chicken (Gallus gallus) [TaxId:9031] [58192] (1 PDB entry)
  8. Domain d1ei3d_: 1ei3 D: [46002]

Details for d1ei3d_

PDB Entry: 1ei3 (more details), 5.5 Å

PDB Description: crystal structure of native chicken fibrinogen

SCOP Domain Sequences for d1ei3d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ei3d_ i.9.1.1 (D:) Fibrinogen {Chicken (Gallus gallus)}
icvdddwgtkcpsccrmqgiiddtdqnysqridnirqqladsqnkyktsnrvivetinil
kpglegaqqldenyghvstelrrrivtlkqrvatqvnrikalqnsiqeqvvemkrlevdi
dikirackgscarsfdyqvdkegydniqkhltq

SCOP Domain Coordinates for d1ei3d_ are not available.

Timeline for d1ei3d_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ei3a_, d1ei3b_, d1ei3c_, d1ei3e_, d1ei3f_