Lineage for d1hqme_ (1hqm E:)

  1. Root: SCOP 1.73
  2. 753709Class i: Low resolution protein structures [58117] (26 folds)
  3. 755052Fold i.8: RNA polymerase [58180] (1 superfamily)
  4. 755053Superfamily i.8.1: RNA polymerase [58181] (1 family) (S)
  5. 755054Family i.8.1.1: RNA polymerase [58182] (2 proteins)
  6. 755205Protein DNA-directed RNA polymerase alpha(2), beta, beta-prime and omega subunits [58183] (1 species)
  7. 755206Species Thermus aquaticus [TaxId:271] [58184] (3 PDB entries)
  8. 755223Domain d1hqme_: 1hqm E: [45976]

Details for d1hqme_

PDB Entry: 1hqm (more details), 3.3 Å

PDB Description: crystal structure of thermus aquaticus core rna polymerase-includes complete structure with side-chains (except for disordered regions)- further refined from original deposition-contains additional sequence information
PDB Compounds: (E:) DNA-directed RNA polymerase

SCOP Domain Sequences for d1hqme_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hqme_ i.8.1.1 (E:) DNA-directed RNA polymerase alpha(2), beta, beta-prime and omega subunits {Thermus aquaticus [TaxId: 271]}
maepgidklfgmvdskyrltvvvakraqqllrhrfkntvlepeerpkmrtleglyddpna
vtwamkelltgrlffgenlvpedrlqkemerlypteee

SCOP Domain Coordinates for d1hqme_:

Click to download the PDB-style file with coordinates for d1hqme_.
(The format of our PDB-style files is described here.)

Timeline for d1hqme_: