SCOP 1.57: Domain d1hqme_: 1hqm E:

Lineage for d1hqme_ (1hqm E:)

1. Root: SCOP 1.57
2. Class i: Low resolution protein structures [58117] (15 folds)
3. Fold i.8: RNA polymerase [58180] (1 superfamily)
4. Superfamily i.8.1: RNA polymerase [58181] (1 family)
5. Family i.8.1.1: RNA polymerase [58182] (1 protein)
6. Protein DNA-directed RNA polymerase alpha(2), beta, beta-prime and omega subunits [58183] (1 species)
7. Species Thermus aquaticus [TaxId:271] [58184] (1 PDB entry)
8. Domain d1hqme_: 1hqm E: [45976]

Details for d1hqme_

PDB Entry: 1hqm, 3.3 Å

PDB Description: crystal structure of thermus aquaticus core rna polymerase-includes complete structure with side-chains (except for disordered regions)- further refined from original deposition-contains additional sequence information

SCOP Domain Sequences for d1hqme_:

Sequence; same for both SEQRES and ATOM records:

>d1hqme_ i.8.1.1 (E:) DNA-directed RNA polymerase alpha(2), beta, beta-prime and omega subunits {Thermus aquaticus}
maepgidklfgmvdskyrltvvvakraqqllrhrfkntvlepeerpkmrtleglyddpna
vtwamkelltgrlffgenlvpedrlqkemerlypteee

SCOP Domain Coordinates for d1hqme_ are not available.

Timeline for d1hqme_:

• d1hqme_ first appeared (with stable ids) in SCOP 1.55
  
• d1hqme_ appears in SCOP 1.59
  
• d1hqme_ appears in the current release, SCOPe 2.08