SCOPe 2.01: Domain d1hqmb_: 1hqm B:

Lineage for d1hqmb_ (1hqm B:)

1. Root: SCOPe 2.01

2. Class i: Low resolution protein structures [58117] (25 folds)

3. Fold i.8: RNA polymerase [58180] (1 superfamily)

4. Superfamily i.8.1: RNA polymerase [58181] (1 family)

5. Family i.8.1.1: RNA polymerase [58182] (2 proteins)

6. Protein DNA-directed RNA polymerase alpha(2), beta, beta-prime and omega subunits [58183] (1 species)

7. Species Thermus aquaticus [TaxId:271] [58184] (3 PDB entries)

8. Domain d1hqmb_: 1hqm B: [45973]
   complexed with mg, zn

Details for d1hqmb_

PDB Entry: 1hqm, 3.3 Å

PDB Description: crystal structure of thermus aquaticus core rna polymerase-includes complete structure with side-chains (except for disordered regions)- further refined from original deposition-contains additional sequence information

PDB Compounds: (B:) DNA-directed RNA polymerase

SCOPe Domain Sequences for d1hqmb_:

Sequence; same for both SEQRES and ATOM records:

>d1hqmb_ i.8.1.1 (B:) DNA-directed RNA polymerase alpha(2), beta, beta-prime and omega subunits {Thermus aquaticus [TaxId: 271]}
esklkapvftattqgdhygefvleplergfgvtlgnplrrillssipgtavtsvyiedvl
hefstipgvkedvveiilnlkelvvrfldprwrttlilraegpkevravdftpsadveim
npdlhiatleeggklymevrvdrgvgyvpaerhgikdrinaipvdaifspvrrvafqved
trlgqrtdldkltlriwtdgsvtplealnqavailkehlnyfanpeasl

Timeline for d1hqmb_:

• d1hqmb_ first appeared (with stable ids) in SCOP 1.55
  
• d1hqmb_ appears in SCOP 1.75
  
• d1hqmb_ appears in SCOPe 2.02
  
• d1hqmb_ appears in the current release, SCOPe 2.08