Lineage for d1hqma_ (1hqm A:)

  1. Root: SCOPe 2.07
  2. 2647132Class i: Low resolution protein structures [58117] (25 folds)
  3. 2649260Fold i.8: RNA polymerase [58180] (1 superfamily)
  4. 2649261Superfamily i.8.1: RNA polymerase [58181] (1 family) (S)
  5. 2649262Family i.8.1.1: RNA polymerase [58182] (2 proteins)
  6. 2649430Protein DNA-directed RNA polymerase alpha(2), beta, beta-prime and omega subunits [58183] (1 species)
  7. 2649431Species Thermus aquaticus [TaxId:271] [58184] (3 PDB entries)
  8. 2649432Domain d1hqma_: 1hqm A: [45972]
    complexed with mg, zn

Details for d1hqma_

PDB Entry: 1hqm (more details), 3.3 Å

PDB Description: crystal structure of thermus aquaticus core rna polymerase-includes complete structure with side-chains (except for disordered regions)- further refined from original deposition-contains additional sequence information
PDB Compounds: (A:) DNA-directed RNA polymerase subunit alpha

SCOPe Domain Sequences for d1hqma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hqma_ i.8.1.1 (A:) DNA-directed RNA polymerase alpha(2), beta, beta-prime and omega subunits {Thermus aquaticus [TaxId: 271]}
lkapvftattqgdhygefvleplergfgvtlgnplrrillssipgtavtsvyiedvlhef
stipgvkedvveiilnlkelvvrfldprwrttlilraegpkevravdftpsadveimnpd
lhiatleeggklymevrvdrgvgyvpaerhgikdrinaipvdaifspvrrvafqvedtrl
gqrtdldkltlriwtdgsvtplealnqavailkehlnyfanpe

SCOPe Domain Coordinates for d1hqma_:

Click to download the PDB-style file with coordinates for d1hqma_.
(The format of our PDB-style files is described here.)

Timeline for d1hqma_: