SCOPe 2.06: Domain d1hqma_: 1hqm A:

Lineage for d1hqma_ (1hqm A:)

1. Root: SCOPe 2.06

2. Class i: Low resolution protein structures [58117] (25 folds)

3. Fold i.8: RNA polymerase [58180] (1 superfamily)

4. Superfamily i.8.1: RNA polymerase [58181] (1 family)

5. Family i.8.1.1: RNA polymerase [58182] (2 proteins)

6. Protein DNA-directed RNA polymerase alpha(2), beta, beta-prime and omega subunits [58183] (1 species)

7. Species Thermus aquaticus [TaxId:271] [58184] (3 PDB entries)

8. Domain d1hqma_: 1hqm A: [45972]
   complexed with mg, zn

Details for d1hqma_

PDB Entry: 1hqm, 3.3 Å

PDB Description: crystal structure of thermus aquaticus core rna polymerase-includes complete structure with side-chains (except for disordered regions)- further refined from original deposition-contains additional sequence information

PDB Compounds: (A:) DNA-directed RNA polymerase

SCOPe Domain Sequences for d1hqma_:

Sequence; same for both SEQRES and ATOM records:

>d1hqma_ i.8.1.1 (A:) DNA-directed RNA polymerase alpha(2), beta, beta-prime and omega subunits {Thermus aquaticus [TaxId: 271]}
lkapvftattqgdhygefvleplergfgvtlgnplrrillssipgtavtsvyiedvlhef
stipgvkedvveiilnlkelvvrfldprwrttlilraegpkevravdftpsadveimnpd
lhiatleeggklymevrvdrgvgyvpaerhgikdrinaipvdaifspvrrvafqvedtrl
gqrtdldkltlriwtdgsvtplealnqavailkehlnyfanpe

Timeline for d1hqma_:

• d1hqma_ first appeared (with stable ids) in SCOP 1.55
  
• d1hqma_ appears in SCOPe 2.05
  
• d1hqma_ appears in SCOPe 2.07
  
• d1hqma_ appears in the current release, SCOPe 2.08