Lineage for d1dyld_ (1dyl D:)

  1. Root: SCOP 1.57
  2. Class i: Low resolution protein structures [58117] (15 folds)
  3. Fold i.6: Virus and virus-receptor complexes [58162] (1 superfamily)
  4. Superfamily i.6.1: Virus and virus-receptor complexes [58163] (1 family) (S)
  5. Family i.6.1.1: Virus and virus-receptor complexes [58164] (5 proteins)
  6. Protein SFV capsid [58173] (1 species)
  7. Species Semliki forest virus [TaxId:11033] [58174] (1 PDB entry)
  8. Domain d1dyld_: 1dyl D: [45966]

Details for d1dyld_

PDB Entry: 1dyl (more details), 9 Å

PDB Description: 9 angstrom resolution cryo-em reconstruction structure of semliki forest virus (sfv) and fitting of the capsid protein structure in the em density

SCOP Domain Sequences for d1dyld_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dyld_ i.6.1.1 (D:) SFV capsid {Semliki forest virus}
cifevkhegkvtgyaclvgdkvmkpahvkgvidnadlaklafkksskydlecaqipvhmr
sdaskythekpeghynwhhgavqysggrftiptgagkpgdsgrpifdnkgrvvaivlgga
negsrtalsvvtwnkdmvtrvtpegseew

SCOP Domain Coordinates for d1dyld_ are not available.

Timeline for d1dyld_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1dyla_, d1dylb_, d1dylc_