SCOPe 2.03: Domain d1qgc1_: 1qgc 1:

Lineage for d1qgc1_ (1qgc 1:)

1. Root: SCOPe 2.03

2. Class i: Low resolution protein structures [58117] (25 folds)

3. Fold i.6: Viruses and virus-receptor complexes [58162] (1 superfamily)

4. Superfamily i.6.1: Viruses and virus-receptor complexes [58163] (1 family)

5. Family i.6.1.1: Viruses and virus-receptor complexes [58164] (12 proteins)

6. Protein FMDV complexed with a neutralizing Fab fragment [58171] (1 species)

7. Species Foot-and-mouth disease virus [TaxId:12110] [58172] (1 PDB entry)

8. Domain d1qgc1_: 1qgc 1: [45958]

Details for d1qgc1_

PDB Entry: 1qgc, 30 Å

PDB Description: structure of the complex of a fab fragment of a neutralizing antibody with foot and mouth disease virus

PDB Compounds: (1:) protein (virus capsid protein)

SCOPe Domain Sequences for d1qgc1_:

Sequence; same for both SEQRES and ATOM records:

>d1qgc1_ i.6.1.1 (1:) FMDV complexed with a neutralizing Fab fragment {Foot-and-mouth disease virus [TaxId: 12110]}
ttttgesadpvtttvenyggetqvqrrhhtdvafvldrfvkvtvsdnqhtldvmqahkdn
ivgallraatyyfsdleiavthtgkltwvpngapvsalnnttnptayhkgpvtrlalpyt
aphrvlataytgtsfnfgavkaetitellvrmkraelycprpilpiqptgdrhkqplvap
akq

Timeline for d1qgc1_:

• d1qgc1_ first appeared (with stable ids) in SCOP 1.55
  
• d1qgc1_ appears in SCOPe 2.02
  
• d1qgc1_ appears in SCOPe 2.04
  
• d1qgc1_ appears in the current release, SCOPe 2.08