Lineage for d1dgi4_ (1dgi 4:)

  1. Root: SCOPe 2.03
  2. 1467789Class i: Low resolution protein structures [58117] (25 folds)
  3. 1469367Fold i.6: Viruses and virus-receptor complexes [58162] (1 superfamily)
  4. 1469368Superfamily i.6.1: Viruses and virus-receptor complexes [58163] (1 family) (S)
  5. 1469369Family i.6.1.1: Viruses and virus-receptor complexes [58164] (12 proteins)
  6. 1469477Protein Poliovirus complexed with three domain CD155 [58169] (1 species)
  7. 1469478Species Human poliovirus type 1 [TaxId:12080] [58170] (2 PDB entries)
  8. 1469489Domain d1dgi4_: 1dgi 4: [45957]
    complexed with myr

Details for d1dgi4_

PDB Entry: 1dgi (more details), 22 Å

PDB Description: cryo-em structure of human poliovirus(serotype 1)complexed with three domain cd155
PDB Compounds: (4:) vp4

SCOPe Domain Sequences for d1dgi4_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dgi4_ i.6.1.1 (4:) Poliovirus complexed with three domain CD155 {Human poliovirus type 1 [TaxId: 12080]}
gaqvssqkvgahensstinyttinyyrdsasnaaskqdfsqdpskftepikdvliktapm
ln

SCOPe Domain Coordinates for d1dgi4_:

Click to download the PDB-style file with coordinates for d1dgi4_.
(The format of our PDB-style files is described here.)

Timeline for d1dgi4_: