SCOP 1.67: Domain d1d3i2_: 1d3i 2:

Lineage for d1d3i2_ (1d3i 2:)

1. Root: SCOP 1.67

2. Class i: Low resolution protein structures [58117] (22 folds)

3. Fold i.6: Viruses and virus-receptor complexes [58162] (1 superfamily)

4. Superfamily i.6.1: Viruses and virus-receptor complexes [58163] (1 family)

5. Family i.6.1.1: Viruses and virus-receptor complexes [58164] (11 proteins)

6. Protein HRV14 complexed with d1d2-ICAM-1 [58167] (1 species)

7. Species Human rhinovirus 14 [TaxId:12131] [58168] (1 PDB entry)

8. Domain d1d3i2_: 1d3i 2: [45950]

Details for d1d3i2_

PDB Entry: 1d3i

PDB Description: cryo-em structure of human rhinovirus 14 (hrv14) complexed with a two- domain fragment of its cellular receptor, intercellular adhesion molecule-1 (d1d2-icam-1). implications for virus-receptor interactions. alpha carbons only

SCOP Domain Sequences for d1d3i2_:

Sequence; same for both SEQRES and ATOM records:

>d1d3i2_ i.6.1.1 (2:) HRV14 complexed with d1d2-ICAM-1 {Human rhinovirus 14}
gysdrvqqitlgnstittqeaanavvcyaewpeylpdvdasdvnktskpdtsvcrfytld
sktwttgskgwcwklpdalkdmgvfgqnmffhslgrsgytvhvqcnatkfhsgcllvvvi
pehqlasheggnvsvkytfthpgergidlssanevggpvkdvlynmngtllgnllifphq
finlrtnntativipyinsvpidsmtrhnnvslmvipiapltvptgatpslpitvtiapm
ctefsgirsksivpq

Timeline for d1d3i2_:

• d1d3i2_ first appeared (with stable ids) in SCOP 1.55
  
• d1d3i2_ appears in SCOP 1.65
  
• d1d3i2_ appears in SCOP 1.69
  
• d1d3i2_ appears in the current release, SCOPe 2.08