Lineage for d1d3ii_ (1d3i I:)

  1. Root: SCOP 1.57
  2. Class i: Low resolution protein structures [58117] (15 folds)
  3. Fold i.6: Virus and virus-receptor complexes [58162] (1 superfamily)
  4. Superfamily i.6.1: Virus and virus-receptor complexes [58163] (1 family) (S)
  5. Family i.6.1.1: Virus and virus-receptor complexes [58164] (5 proteins)
  6. Protein HRV14 complexed with d1d2-ICAM-1 [58167] (1 species)
  7. Species Human rhinovirus 14 [TaxId:12131] [58168] (1 PDB entry)
  8. Domain d1d3ii_: 1d3i I: [45948]

Details for d1d3ii_

PDB Entry: 1d3i (more details)

PDB Description: cryo-em structure of human rhinovirus 14 (hrv14) complexed with a two- domain fragment of its cellular receptor, intercellular adhesion molecule-1 (d1d2-icam-1). implications for virus-receptor interactions. alpha carbons only

SCOP Domain Sequences for d1d3ii_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d3ii_ i.6.1.1 (I:) HRV14 complexed with d1d2-ICAM-1 {Human rhinovirus 14}
qtsvspskvilprggsvlvtcstscdqpkllgietplpkkelllpgnnrkvyelsnvqed
sqpmcysncpdgqstaktfltvywtpervelaplpswqpvgknltlrcqveggapranlt
vvllrgekelkrepavgepaevtttvlvrrdhhganfscrteldlrpqglelfentsapy
qlqtf

SCOP Domain Coordinates for d1d3ii_ are not available.

Timeline for d1d3ii_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1d3i1_, d1d3i2_, d1d3i3_, d1d3i4_