Lineage for d1d3e3_ (1d3e 3:)

  1. Root: SCOPe 2.03
  2. 1467789Class i: Low resolution protein structures [58117] (25 folds)
  3. 1469367Fold i.6: Viruses and virus-receptor complexes [58162] (1 superfamily)
  4. 1469368Superfamily i.6.1: Viruses and virus-receptor complexes [58163] (1 family) (S)
  5. 1469369Family i.6.1.1: Viruses and virus-receptor complexes [58164] (12 proteins)
  6. 1469406Protein HRV16 complexed with d1d2-ICAM-1 [58165] (1 species)
  7. 1469407Species Human rhinovirus 16 [TaxId:31708] [58166] (1 PDB entry)
  8. 1469410Domain d1d3e3_: 1d3e 3: [45946]

Details for d1d3e3_

PDB Entry: 1d3e (more details), 28 Å

PDB Description: cryo-em structure of human rhinovirus 16 (hrv16) complexed with a two- domain fragment of its cellular receptor, intercellular adhesion molecule-1 (d1d2-icam-1). implications for virus-receptor interactions. alpha carbons only
PDB Compounds: (3:) protein (rhinovirus 16 coat protein vp3)

SCOPe Domain Sequences for d1d3e3_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d3e3_ i.6.1.1 (3:) HRV16 complexed with d1d2-ICAM-1 {Human rhinovirus 16 [TaxId: 31708]}
glpvyvtpgsgqfmttddmqspcalpwyhptkeifipgevknliemcqvdtlipinstqs
nignvsmytvtlspqtklaeeifaikvdiashplattligeiasyfthwtgslrfsfmfc
gtanttlkvllaytppgigkprsrkeamlgthvvwdvglqstvslvvpwisasqyrfttp
dtyssagyitcwyqtnfvvppntpntaemlcfvsgckdfclrmardtdlhkqtgpitq

SCOPe Domain Coordinates for d1d3e3_:

Click to download the PDB-style file with coordinates for d1d3e3_.
(The format of our PDB-style files is described here.)

Timeline for d1d3e3_: