Lineage for d1e08e_ (1e08 E:)

  1. Root: SCOPe 2.07
  2. 2647132Class i: Low resolution protein structures [58117] (25 folds)
  3. 2648894Fold i.4: Electron transport chains [58146] (1 superfamily)
  4. 2648895Superfamily i.4.1: Electron transport chains [58147] (1 family) (S)
  5. 2648896Family i.4.1.1: Electron transport chains [58148] (3 proteins)
    not a true family
  6. 2648907Protein [Fe]-hydrogenase/cytochrome c553 complex [58153] (1 species)
  7. 2648908Species interspecies complex: Desulfovibrio desulfuricans and Desulfovibrio vulgaris [58154] (1 PDB entry)
  8. 2648911Domain d1e08e_: 1e08 E: [45916]
    complexed with cmo, cyn, fe2, hem, pdt, sf4, zn

Details for d1e08e_

PDB Entry: 1e08 (more details)

PDB Description: structural model of the [fe]-hydrogenase/cytochrome c553 complex combining nmr and soft-docking
PDB Compounds: (E:) cytochrome c553

SCOPe Domain Sequences for d1e08e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e08e_ i.4.1.1 (E:) [Fe]-hydrogenase/cytochrome c553 complex {interspecies complex: Desulfovibrio desulfuricans and Desulfovibrio vulgaris}
dgaalykscigchgadgskaamgsakpvkgqgaeelykkmkgyadgsyggerkammtnav
kkysdeelkaladymskl

SCOPe Domain Coordinates for d1e08e_:

Click to download the PDB-style file with coordinates for d1e08e_.
(The format of our PDB-style files is described here.)

Timeline for d1e08e_: