Lineage for d1e08e_ (1e08 E:)

  1. Root: SCOP 1.63
  2. 272796Class i: Low resolution protein structures [58117] (18 folds)
  3. 273223Fold i.4: Electron transport chains [58146] (1 superfamily)
  4. 273224Superfamily i.4.1: Electron transport chains [58147] (1 family) (S)
  5. 273225Family i.4.1.1: Electron transport chains [58148] (3 proteins)
    not a true family
  6. 273234Protein [Fe]-hydrogenase/cytochrome c553 complex [58153] (1 species)
  7. 273235Species Desulfovibrio desulfuricans and Desulfovibrio vulgaris [58154] (1 PDB entry)
  8. 273238Domain d1e08e_: 1e08 E: [45916]

Details for d1e08e_

PDB Entry: 1e08 (more details)

PDB Description: structural model of the [fe]-hydrogenase/cytochrome c553 complex combining nmr and soft-docking

SCOP Domain Sequences for d1e08e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e08e_ i.4.1.1 (E:) [Fe]-hydrogenase/cytochrome c553 complex {Desulfovibrio desulfuricans and Desulfovibrio vulgaris}
dgaalykscigchgadgskaamgsakpvkgqgaeelykkmkgyadgsyggerkammtnav
kkysdeelkaladymskl

SCOP Domain Coordinates for d1e08e_:

Click to download the PDB-style file with coordinates for d1e08e_.
(The format of our PDB-style files is described here.)

Timeline for d1e08e_: