![]() | Class i: Low resolution protein structures [58117] (17 folds) |
![]() | Fold i.4: Electron transport chains [58146] (1 superfamily) |
![]() | Superfamily i.4.1: Electron transport chains [58147] (1 family) ![]() |
![]() | Family i.4.1.1: Electron transport chains [58148] (3 proteins) |
![]() | Protein [Fe]-hydrogenase/cytochrome c553 complex [58153] (1 species) |
![]() | Species Desulfovibrio desulfuricans and Desulfovibrio vulgaris [58154] (1 PDB entry) |
![]() | Domain d1e08d_: 1e08 D: [45915] |
PDB Entry: 1e08 (more details)
SCOP Domain Sequences for d1e08d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e08d_ i.4.1.1 (D:) [Fe]-hydrogenase/cytochrome c553 complex {Desulfovibrio desulfuricans and Desulfovibrio vulgaris} vkqikdymldringvygadakfpvrasqdntqvkalyksylekplghkshdllhthwfdk skgvkelttagklpnprasefegpypye
Timeline for d1e08d_: