Lineage for d1e08a_ (1e08 A:)

  1. Root: SCOP 1.61
  2. 206238Class i: Low resolution protein structures [58117] (17 folds)
  3. 206618Fold i.4: Electron transport chains [58146] (1 superfamily)
  4. 206619Superfamily i.4.1: Electron transport chains [58147] (1 family) (S)
  5. 206620Family i.4.1.1: Electron transport chains [58148] (3 proteins)
  6. 206629Protein [Fe]-hydrogenase/cytochrome c553 complex [58153] (1 species)
  7. 206630Species Desulfovibrio desulfuricans and Desulfovibrio vulgaris [58154] (1 PDB entry)
  8. 206631Domain d1e08a_: 1e08 A: [45914]

Details for d1e08a_

PDB Entry: 1e08 (more details)

PDB Description: structural model of the [fe]-hydrogenase/cytochrome c553 complex combining nmr and soft-docking

SCOP Domain Sequences for d1e08a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e08a_ i.4.1.1 (A:) [Fe]-hydrogenase/cytochrome c553 complex {Desulfovibrio desulfuricans and Desulfovibrio vulgaris}
fvqideakcigcdtcsqycptaaifgemgephsiphieacincgqclthcpenaiyeaqs
wvpevekklkdgkvkciampapavryalgdafgmpvgsvttgkmlaalqklgfahcwdte
ftadvtiweegsefverltkksdmplpqftsccpgwqkyaetyypellphfstckspigm
ngalaktygaermkydpkqvytvsimpciakkyeglrpelkssgmrdidatlttrelaym
ikkagidfaklpdgkrdslmgestggatifgvtggvmeaalrfayeavtgkkpdswdfka
vrgldgikeatvnvggtdvkvavvhgakrfkqvcddvkagkspyhfieymacpggcvcgg
gqpvmpgvlea

SCOP Domain Coordinates for d1e08a_:

Click to download the PDB-style file with coordinates for d1e08a_.
(The format of our PDB-style files is described here.)

Timeline for d1e08a_: