Lineage for d1e08a_ (1e08 A:)

  1. Root: SCOPe 2.08
  2. 3042554Class i: Low resolution protein structures [58117] (25 folds)
  3. 3044316Fold i.4: Electron transport chains [58146] (1 superfamily)
  4. 3044317Superfamily i.4.1: Electron transport chains [58147] (1 family) (S)
  5. 3044318Family i.4.1.1: Electron transport chains [58148] (3 proteins)
    not a true family
  6. 3044329Protein [Fe]-hydrogenase/cytochrome c553 complex [58153] (1 species)
  7. 3044330Species interspecies complex: Desulfovibrio desulfuricans and Desulfovibrio vulgaris [58154] (1 PDB entry)
  8. 3044331Domain d1e08a_: 1e08 A: [45914]
    complexed with cmo, cyn, fe2, hec, pdt, sf4, zn

Details for d1e08a_

PDB Entry: 1e08 (more details)

PDB Description: structural model of the [fe]-hydrogenase/cytochrome c553 complex combining nmr and soft-docking
PDB Compounds: (A:) [fe]-hydrogenase (large subunit)

SCOPe Domain Sequences for d1e08a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e08a_ i.4.1.1 (A:) [Fe]-hydrogenase/cytochrome c553 complex {interspecies complex: Desulfovibrio desulfuricans and Desulfovibrio vulgaris}
fvqideakcigcdtcsqycptaaifgemgephsiphieacincgqclthcpenaiyeaqs
wvpevekklkdgkvkciampapavryalgdafgmpvgsvttgkmlaalqklgfahcwdte
ftadvtiweegsefverltkksdmplpqftsccpgwqkyaetyypellphfstckspigm
ngalaktygaermkydpkqvytvsimpciakkyeglrpelkssgmrdidatlttrelaym
ikkagidfaklpdgkrdslmgestggatifgvtggvmeaalrfayeavtgkkpdswdfka
vrgldgikeatvnvggtdvkvavvhgakrfkqvcddvkagkspyhfieymacpggcvcgg
gqpvmpgvlea

SCOPe Domain Coordinates for d1e08a_:

Click to download the PDB-style file with coordinates for d1e08a_.
(The format of our PDB-style files is described here.)

Timeline for d1e08a_: