Lineage for d1dwla_ (1dwl A:)

  1. Root: SCOPe 2.07
  2. 2647132Class i: Low resolution protein structures [58117] (25 folds)
  3. 2648894Fold i.4: Electron transport chains [58146] (1 superfamily)
  4. 2648895Superfamily i.4.1: Electron transport chains [58147] (1 family) (S)
  5. 2648896Family i.4.1.1: Electron transport chains [58148] (3 proteins)
    not a true family
  6. 2648903Protein Ferredoxin-cytochrome complex [58151] (1 species)
  7. 2648904Species interspecies complex: Desulfomicrobium norvegicum and Desulfovibrio vulgaris [58152] (1 PDB entry)
  8. 2648905Domain d1dwla_: 1dwl A: [45912]
    complexed with hec, sf4

Details for d1dwla_

PDB Entry: 1dwl (more details)

PDB Description: the ferredoxin-cytochrome complex using heteronuclear nmr and docking simulation
PDB Compounds: (A:) ferredoxin I

SCOPe Domain Sequences for d1dwla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dwla_ i.4.1.1 (A:) Ferredoxin-cytochrome complex {interspecies complex: Desulfomicrobium norvegicum and Desulfovibrio vulgaris}
tividheecigcescvelcpevfamidgeekamvtapdstaecaqdaidacpveaiske

SCOPe Domain Coordinates for d1dwla_:

Click to download the PDB-style file with coordinates for d1dwla_.
(The format of our PDB-style files is described here.)

Timeline for d1dwla_: