![]() | Class i: Low resolution protein structures [58117] (25 folds) |
![]() | Fold i.4: Electron transport chains [58146] (1 superfamily) |
![]() | Superfamily i.4.1: Electron transport chains [58147] (1 family) ![]() |
![]() | Family i.4.1.1: Electron transport chains [58148] (3 proteins) not a true family |
![]() | Protein Ferredoxin-cytochrome complex [58151] (1 species) |
![]() | Species interspecies complex: Desulfomicrobium norvegicum and Desulfovibrio vulgaris [58152] (1 PDB entry) |
![]() | Domain d1dwla_: 1dwl A: [45912] complexed with hec, sf4 |
PDB Entry: 1dwl (more details)
SCOPe Domain Sequences for d1dwla_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dwla_ i.4.1.1 (A:) Ferredoxin-cytochrome complex {interspecies complex: Desulfomicrobium norvegicum and Desulfovibrio vulgaris} tividheecigcescvelcpevfamidgeekamvtapdstaecaqdaidacpveaiske
Timeline for d1dwla_: