Lineage for d1dwla_ (1dwl A:)

  1. Root: SCOP 1.57
  2. Class i: Low resolution protein structures [58117] (15 folds)
  3. Fold i.4: Electron transport chains [58146] (1 superfamily)
  4. Superfamily i.4.1: Electron transport chains [58147] (1 family) (S)
  5. Family i.4.1.1: Electron transport chains [58148] (3 proteins)
  6. Protein Ferredoxin-cytochrome complex [58151] (1 species)
  7. Species Desulfomicrobium norvegicum and Desulfovibrio vulgaris [58152] (1 PDB entry)
  8. Domain d1dwla_: 1dwl A: [45912]

Details for d1dwla_

PDB Entry: 1dwl (more details)

PDB Description: the ferredoxin-cytochrome complex using heteronuclear nmr and docking simulation

SCOP Domain Sequences for d1dwla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dwla_ i.4.1.1 (A:) Ferredoxin-cytochrome complex {Desulfomicrobium norvegicum and Desulfovibrio vulgaris}
tividheecigcescvelcpevfamidgeekamvtapdstaecaqdaidacpveaiske

SCOP Domain Coordinates for d1dwla_ are not available.

Timeline for d1dwla_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1dwlb_