Lineage for d2pcfb_ (2pcf B:)

  1. Root: SCOPe 2.06
  2. 2268314Class i: Low resolution protein structures [58117] (25 folds)
  3. 2270076Fold i.4: Electron transport chains [58146] (1 superfamily)
  4. 2270077Superfamily i.4.1: Electron transport chains [58147] (1 family) (S)
  5. 2270078Family i.4.1.1: Electron transport chains [58148] (3 proteins)
    not a true family
  6. 2270079Protein Cytochrome f-plastocyanin complex [58149] (2 species)
  7. 2270082Species Plant (Spinacia oleracea) and (Brassica rapa) [TaxId:3562] [58150] (1 PDB entry)
  8. 2270084Domain d2pcfb_: 2pcf B: [45911]
    complexed with cu, hec

Details for d2pcfb_

PDB Entry: 2pcf (more details)

PDB Description: the complex of cytochrome f and plastocyanin determined with paramagnetic nmr. based on the structures of cytochrome f and plastocyanin, 10 structures
PDB Compounds: (B:) cytochrome f

SCOPe Domain Sequences for d2pcfb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pcfb_ i.4.1.1 (B:) Cytochrome f-plastocyanin complex {Plant (Spinacia oleracea) and (Brassica rapa) [TaxId: 3562]}
ypifaqqnyenpreatgrivcanchlaskpvdievpqavlpdtvfeavvkipydmqlkqv
langkkgalnvgavlilpegfelappdrispemkekignlsfqnyrpnkknilvigpvpg
qkyseitfpilapdpatnkdvhflkypiyvggnrgrgqiypdgsksnntvynataggiis
kilrkekggyeitivdasnerqvidiiprglellvsegesikldqpltsnpnvggfgqgd
aeivlqdplr

SCOPe Domain Coordinates for d2pcfb_:

Click to download the PDB-style file with coordinates for d2pcfb_.
(The format of our PDB-style files is described here.)

Timeline for d2pcfb_: