SCOPe 2.03: Domain d2pcfb_: 2pcf B:

Lineage for d2pcfb_ (2pcf B:)

1. Root: SCOPe 2.03

2. Class i: Low resolution protein structures [58117] (25 folds)

3. Fold i.4: Electron transport chains [58146] (1 superfamily)

4. Superfamily i.4.1: Electron transport chains [58147] (1 family)

5. Family i.4.1.1: Electron transport chains [58148] (3 proteins)
   not a true family

6. Protein Cytochrome f-plastocyanin complex [58149] (2 species)

7. Species Plant (Spinacia oleracea) and (Brassica rapa) [TaxId:3562] [58150] (1 PDB entry)

8. Domain d2pcfb_: 2pcf B: [45911]
   complexed with cu, hec

Details for d2pcfb_

PDB Entry: 2pcf

PDB Description: the complex of cytochrome f and plastocyanin determined with paramagnetic nmr. based on the structures of cytochrome f and plastocyanin, 10 structures

PDB Compounds: (B:) cytochrome f

SCOPe Domain Sequences for d2pcfb_:

Sequence; same for both SEQRES and ATOM records:

>d2pcfb_ i.4.1.1 (B:) Cytochrome f-plastocyanin complex {Plant (Spinacia oleracea) and (Brassica rapa) [TaxId: 3562]}
ypifaqqnyenpreatgrivcanchlaskpvdievpqavlpdtvfeavvkipydmqlkqv
langkkgalnvgavlilpegfelappdrispemkekignlsfqnyrpnkknilvigpvpg
qkyseitfpilapdpatnkdvhflkypiyvggnrgrgqiypdgsksnntvynataggiis
kilrkekggyeitivdasnerqvidiiprglellvsegesikldqpltsnpnvggfgqgd
aeivlqdplr

Timeline for d2pcfb_:

• d2pcfb_ first appeared (with stable ids) in SCOP 1.55
  
• d2pcfb_ appears in SCOPe 2.02
  
• d2pcfb_ appears in SCOPe 2.04
  
• d2pcfb_ appears in the current release, SCOPe 2.08