| Class i: Low resolution protein structures [58117] (16 folds) |
| Fold i.4: Electron transport chains [58146] (1 superfamily) |
Superfamily i.4.1: Electron transport chains [58147] (1 family) ![]() |
| Family i.4.1.1: Electron transport chains [58148] (3 proteins) |
| Protein Cytochrome f-plastocyanin complex [58149] (1 species) |
| Species Plant (Spinacia oleracea) and (Brassica rapa) [TaxId:3562] [58150] (1 PDB entry) |
| Domain d2pcfa_: 2pcf A: [45910] |
PDB Entry: 2pcf (more details)
SCOP Domain Sequences for d2pcfa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pcfa_ i.4.1.1 (A:) Cytochrome f-plastocyanin complex {Plant (Spinacia oleracea) and (Brassica rapa)}
vevllgggdgslaflpgdfsvasgeeivfknnagfphnvvfdedeipsgvdaakismsee
dllnapgetykvtltekgtykfycsphqgagmvgkvtvn
Timeline for d2pcfa_: