SCOP 1.59: Domain d2pcfa_: 2pcf A:

Lineage for d2pcfa_ (2pcf A:)

1. Root: SCOP 1.59

2. Class i: Low resolution protein structures [58117] (16 folds)

3. Fold i.4: Electron transport chains [58146] (1 superfamily)

4. Superfamily i.4.1: Electron transport chains [58147] (1 family)

5. Family i.4.1.1: Electron transport chains [58148] (3 proteins)

6. Protein Cytochrome f-plastocyanin complex [58149] (1 species)

7. Species Plant (Spinacia oleracea) and (Brassica rapa) [TaxId:3562] [58150] (1 PDB entry)

8. Domain d2pcfa_: 2pcf A: [45910]

Details for d2pcfa_

PDB Entry: 2pcf

PDB Description: the complex of cytochrome f and plastocyanin determined with paramagnetic nmr. based on the structures of cytochrome f and plastocyanin, 10 structures

SCOP Domain Sequences for d2pcfa_:

Sequence; same for both SEQRES and ATOM records:

>d2pcfa_ i.4.1.1 (A:) Cytochrome f-plastocyanin complex {Plant (Spinacia oleracea) and (Brassica rapa)}
vevllgggdgslaflpgdfsvasgeeivfknnagfphnvvfdedeipsgvdaakismsee
dllnapgetykvtltekgtykfycsphqgagmvgkvtvn

Timeline for d2pcfa_:

• d2pcfa_ first appeared (with stable ids) in SCOP 1.55
  
• d2pcfa_ appears in SCOP 1.57
  
• d2pcfa_ appears in SCOP 1.61
  
• d2pcfa_ appears in the current release, SCOPe 2.08