Lineage for d2pcfa_ (2pcf A:)

  1. Root: SCOP 1.55
  2. Class i: Low resolution protein structures [58117] (12 folds)
  3. Fold i.4: Electron transport chains [58146] (1 superfamily)
  4. Superfamily i.4.1: Electron transport chains [58147] (1 family) (S)
  5. Family i.4.1.1: Electron transport chains [58148] (3 proteins)
  6. Protein Cytochrome f-plastocyanin complex [58149] (1 species)
  7. Species Plant (Spinacia oleracea) and (Brassica rapa) [TaxId:3562] [58150] (1 PDB entry)
  8. Domain d2pcfa_: 2pcf A: [45910]

Details for d2pcfa_

PDB Entry: 2pcf (more details)

PDB Description: the complex of cytochrome f and plastocyanin determined with paramagnetic nmr. based on the structures of cytochrome f and plastocyanin, 10 structures

SCOP Domain Sequences for d2pcfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pcfa_ i.4.1.1 (A:) Cytochrome f-plastocyanin complex {Plant (Spinacia oleracea) and (Brassica rapa)}
vevllgggdgslaflpgdfsvasgeeivfknnagfphnvvfdedeipsgvdaakismsee
dllnapgetykvtltekgtykfycsphqgagmvgkvtvn

SCOP Domain Coordinates for d2pcfa_ are not available.

Timeline for d2pcfa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2pcfb_