Lineage for d1emia_ (1emi A:)

  1. Root: SCOPe 2.01
  2. 1069520Class i: Low resolution protein structures [58117] (25 folds)
  3. 1069521Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 1069522Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 1070814Family i.1.1.3: Small subunit [58132] (1 protein)
  6. 1070815Protein 30S subunit [58133] (1 species)
  7. 1070816Species Thermus thermophilus [TaxId:274] [58134] (13 PDB entries)
  8. 1070855Domain d1emia_: 1emi A: [45877]

Details for d1emia_

PDB Entry: 1emi (more details), 7.5 Å

PDB Description: structure of 16s rrna in the region around ribosomal protein s8.
PDB Compounds: (A:) ribosomal protein s8

SCOPe Domain Sequences for d1emia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1emia_ i.1.1.3 (A:) 30S subunit {Thermus thermophilus [TaxId: 274]}
tdpiadmltrirnatrvykestdvpasrfkeeilrilaregfikgyervdvdgkpylrvy
lkygprrqgpdprpeqvihhirriskpgrrvyvgvkeiprvrrglgiailstskgvltdr
earklgvggelicevw

SCOPe Domain Coordinates for d1emia_:

Click to download the PDB-style file with coordinates for d1emia_.
(The format of our PDB-style files is described here.)

Timeline for d1emia_: