Lineage for d1emia_ (1emi A:)

  1. Root: SCOP 1.55
  2. Class i: Low resolution protein structures [58117] (12 folds)
  3. Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. Family i.1.1.3: Small subunit [58132] (1 protein)
  6. Protein 30S subunit [58133] (1 species)
  7. Species Thermus thermophilus [TaxId:274] [58134] (4 PDB entries)
  8. Domain d1emia_: 1emi A: [45877]

Details for d1emia_

PDB Entry: 1emi (more details), 7.5 Å

PDB Description: structure of 16s rrna in the region around ribosomal protein s8.

SCOP Domain Sequences for d1emia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1emia_ i.1.1.3 (A:) 30S subunit {Thermus thermophilus}
tdpiadmltrirnatrvykestdvpasrfkeeilrilaregfikgyervdvdgkpylrvy
lkygprrqgpdprpeqvihhirriskpgrrvyvgvkeiprvrrglgiailstskgvltdr
earklgvggelicevw

SCOP Domain Coordinates for d1emia_ are not available.

Timeline for d1emia_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1emib_